PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13595g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 252aa    MW: 27437.5 Da    PI: 9.2042
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf13595g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393595262
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rkn+k+s
  Niben101Scf13595g00004.1 35 KDQAINCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNNKRS 95
                              5799*****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272287IPR003851Zinc finger, Dof-type
PfamPF027013.3E-333693IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7793993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
METTQWTQDI GIVKSMAAEI AAPNVTVEKK VRPVKDQAIN CPRCNSTNTK FCYYNNYSLT  60
QPRYFCKTCR RYWTEGGTLR NVPVGGGSRK NNKRSSSSSS SSTQKLPDLN PNSSFSPQNP  120
NKIIVGNSCQ DLNLGFQTVS HDHQFHGSTP ISALELLRSG IASRGFTSFI TSPAPPDLNT  180
LYTSGFPFQE LKPSAGSNDH AAAALSYSNG VQENGGARIM FPLGADHHHH QSKGQENSTA  240
VYWNGMLGGG SW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760287.11e-167PREDICTED: dof zinc finger protein DOF2.5 isoform X2
RefseqXP_016463172.11e-167PREDICTED: dof zinc finger protein DOF2.5-like isoform X3
SwissprotQ433853e-59DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLK4B0011e-100K4B001_SOLLC; Uncharacterized protein
STRINGSolyc01g096120.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-49Dof family protein